I sette stadi di conoscenza (7 bhumika)
GLI INSEGNAMENTI SPIRITUALI
di Ramana Maharshi
E' da un po' di tempo che mi sto dedicando all'approfondimento dei sette stadi di conoscenza (7 Bhumika) indicati da Sri Ramana nei suoi Insegnamenti Spirituali. Nel corso di questa ricerca ho trovato riscontro a quanto esposto da Sri Ramana nei Testi sacri, le Upanisad.
Malauguratamente si tratta, in genere, di Upanisad non tradotte in italiano ma, poiché l'argomento dei 7 Bhumika – e loro implicazioni- non mi pare sia ancora mai stato trattato qui sul Forum, ritengo possa risultare comunque utile. Siccome l'esposizione risulterà alla fine piuttosto lunga, ho pensato di suddividere il tutto in vari post.
Cominciamo dal testo di Sri Ramana già presente qui nel Forum:
INSEGNAMENTI SPIRITUALI
(Upadesha Manjari)
di Ramana Maharshi
***
CAPITOLO IV
CONSEGUIMENTO (ARUDHA)
1. Qual è lo stato di conseguimento della conoscenza?
E' il dimorare fermo e senza sforzo nel Sé in cui la mente che è divenuta uno con il Sé non emerge ancora in seguito mai più. Questo è, così come ognuno si rende conto abitualmente e naturalmente che, "io non sono una capra né una mucca né alcun altro animale ma un uomo", quando pensa al suo corpo, così anche quando si rende conto che "io non sono i principi (tatwas) che cominciano con il corpo e finiscono con il suono (nada), ma il Sé che è esistenza, coscienza e beatitudine", l'innata autocoscienza (atmaprajna), egli è detto aver conseguito una ferma conoscenza.
2. A quale dei sette stadi di conoscenza (jnana-bhoomikas) appartiene il saggio?
Egli appartiene al quarto stadio.
3. Se è così perché esistono tre stadi che possono essere distinti superiori ad esso?
I segni degli stadi da quattro a sette sono basati sull'esperienza della persona realizzata (jivanmukta). Essi non sono stadi di conoscenza e di realizzazione. Fino a che conoscenza e realizzazione hanno influenza, non vi è alcuna distinzione qualsiasi cosa sia fatta in questi quattro stadi.
I sette jnana bhoomikas sono:
1. subheccha (desiderio d’illuminazione)
2. vicharana (indagine)
3. tanumanasa (mente tenue)
4. satwapatti (autorealizzazione)
5. asamsakti (non attaccamento)
6. padarthabhavana (non percezione degli oggetti)
7. turyaga (trascendenza)
Coloro che hanno conseguito i quattro ultimi bhoomikas sono detti brahmavit, brahmavidvara, brahmavidvariya e brahmavid varistha rispettivamente.
4. Dato che la liberazione è comune a tutti, perché soltanto il varistha (lett. il più eccellente) è lodato eccessivamente?
Fino a che la comune esperienza di beatitudine del varistha ha influenza egli è lodato solo a causa degli speciali meriti acquisiti nelle sue vite precedenti che sono la causa di ciò.
5. Poiché non esiste nessuno che non desideri sperimentare una costante beatitudine qual è la ragione per cui non a tutti i saggi riesce di conseguire lo stato di varistha?
Non può essere ottenuto dal puro desiderio o dallo sforzo. Il karma (prarabdha) è la sua causa. Poiché l'ego muore insieme alle sue cause già nei quattro stadi (bhoomika), quale agente rimane oltre quel livello per desiderare qualcosa o fare sforzi? Fino a che compiranno sforzi non saranno saggi (jnanis). Forse che le sacre scritture (sruti) con una menzione speciale per il varistha dicono che gli altri tre sono persone non illuminate?
6. Dato che qualche testo sacro dice che lo stato supremo è quello in cui gli organi dei sensi e la mente sono completamente distrutti, come può quello stato essere compatibile con l'esperienza del corpo e dei sensi?
Se ciò è avvenuto non dovrebbero più esserci differenze tra quello stato e lo stato di sonno profondo. Inoltre come si può dire che sia lo stato naturale quando esiste una volta e l'altra no? Ciò accade a qualche persona, come si è detto prima, in accordo con il suo karma (prarabdha) per qualche tempo o sino alla morte. Non può essere visto esattamente come lo stato finale. Se così fosse ciò significherebbe che tutte le grandi anime ed il Signore, che sono stati gli autori dei lavori Vedantici (jnana granthas) e dei Veda, sono stati persone non illuminate. Se lo stato supremo è quello in cui né i sensi né la mente esistono e neppure lo stato in cui essi esistono come potrebbe essere lo stato perfetto (paripurnam)? Poiché soltanto il karma è responsabile dell'attività o dell'inattività dei saggi, le grandi anime hanno decretato essere lo stato ultimo soltanto quello di sahaja nirvikalpa (lo stato naturale senza concetti).
7. Qual è la differenza tra sonno ordinario e sonno cosciente (jagrat sushupti)?
Nel sonno ordinario non solo non vi sono pensieri, ma neppure consapevolezza. Nel sonno cosciente c'è soltanto consapevolezza. Questo è il motivo per cui è chiamato cosciente sebbene dormiente, questo è il sonno in cui c'è consapevolezza.
8. Perchè il Sé è descritto in entrambi i modi, come quarto stato e come oltre il quarto stato (turiyatita)?
Turiya significa che quello è il quarto. Gli sperimentatori (jivas) dei tre stati di veglia, sogno e sonno profondo, conosciuti come visva, taijasa e prajna, che vagano in successione in questi tre stati, non sono il Sé. E’ con l'obbiettivo di rendere ciò chiaro, vale ad dire che il Sé è ciò che è diverso da essi e che è testimone di quegli stati, che esso è chiamato il quarto (turiya). Quando questo viene compreso i tre sperimentatori scompaiono e l'idea che il Sé è il testimone, che è il quarto, pure scompare. Questo è il motivo per cui il Sé viene descritto come oltre il quarto (turiyatita).
9. Qual è il beneficio derivato al saggio dalle sacre scritture (srutis)?
Per il saggio che è l'incarnazione delle verità menzionate nelle scritture esse non hanno utilizzo.
10. Vi è qualche connessione tra il conseguimento dei poteri supernaturali (siddhis) e la Liberazione (mukti)?
Soltanto l'indagine illuminata conduce alla Liberazione. I poteri supernaturali sono tutti apparenze illusorie create dal potere di maya (mayashakti). L'autorealizzazione che è permanente è il solo vero talento (siddhi). I talenti che appaiono e scompaiono, essendo effetti di maya, non possono essere reali. Essi sono compiuti con l'obbiettivo di raggiungere fama, piaceri, ecc. Essi compaiono spontanei in qualche persona grazie al loro karma. Sappi che l'unione con il Brahman è lo scopo reale di tutti i talenti. Questo è anche lo stato di Liberazione (aikya mukti) conosciuto come unione (sayujya).
(...)
1. continua...
I SETTE BHUMIKA NELLE UPANISAD
Una delle Upanisad in cui si trovano esposti i sette stadi di conoscenza (7 Bhumika) è la Mahopanisad, facente parte del Sama-Veda:
MAHA UPANISHAD
Translated by Dr. A. G. Krishna Warrier
*
Chapter V.
(…)
V-21-35.
By knowing the seven stages of knowledge, one will not be sub-merged in the mire of illusions.
Many schools speak variously of the stages of Yoga but only the following are acceptable to me:
liberation follows after the seven stages.
The first stage of knowledge – is auspicious desire, the second is reflection, the third is thinning of the mind, the fourth is attainment of Sattva, then detachment, the sixth is reflection on objects and the seventh is of the Turiya.
Their explanation:
The wise say that the auspicious desire is the desire following detachment –meditation ‘why do I remain like a fool, being looked upon by good people ?’
Reflection is good activity (tendency) after the practice of detachment and contact with scriptures and good people.
Thinning of the Mind is the condition where the attachment to sense-objects is reduced by means of auspicious desire and reflection.
Sattvapatti is the mind in the pure Sattva condition by the practice of the above three stages.
The Asamsakti stage is the developed condition, without even a trace of involvement, by means of the practice of the four stages.
Padarthabhavana is the sixth stage resulting from the five stages, delighting in the spirit firmly by the non-contemplation of objects internal and external.
The ‘Fourth’ (Transcendental) condition (here the seventh) is concentration on one’s nature, seeing no real difference, by the long practice of the six stages – this is the stage of Jivanmukti.
The stage ‘Beyond the Fourth’ is the stage of liberation without the body.
V-36-40.
Nidagha, those who have reached the seventh stage, delight in the spirit – they do not drown in pleasure and pain.
They do (or not do) whatever is only relevant and minimal.
They perform actions following the past, awakened (impelled) by those nearby, like one waking from sleep.
These seven stages can be known only by the enlightened – reaching which condition, even animals, barbarians etc., are liberated with or without the body surely.
Wisdom indeed is the breaking of the knot and the liberation – the dying of the illusion of mirage.
V-41.
But those who have crossed the ocean of illusion – they have reached the high position.
V-42-43.
The means of calming the mind is said to be Yoga.
This is to be known as having seven stages which lead to the status of Brahman.
V-44.
There, there is no feeling of ‘you’ and ‘I’, one’s own and another, nor the perception of existence or non-existence.
V-45.
All is calm (needing) no support, existing in the ether (of the heart), eternal, auspicious, devoid of ailment and illusion, name and cause.
V-46.
Neither existent nor-existent, nor in between, nor the negation of all; beyond the grasp of mind and words, fuller than the fullest, more joyful than joy.
V-47.
Beyond (worldly) perception, the limit of one’s hope (horizon) extensive, there is no existence of any thing other than pure cognition.
(…)
* * * * *
Ancora, se ne trova una breve esposizione nell'Annapurna Upanisad, facente parte dell'Atharva-Veda:
ANNAPURNA UPANISHAD
Translated by Dr. A. G. Krishna Warrier
*
Chapter V.
(…)
V-81. The first plane, generating the desire for liberation, is marked by the practice (of discipline) and detachment due to intimacy with the Shastras and the company of the holy.
V-82. The second is marked by investigation;
the third by contemplation with (all) its accessories;
the fourth is the solvent as it consists in the dissolution of latent impressions.
V-83. The fifth is the rapturous; it is purely cognitive.
This is the station of the Liberated-in-life who is, as it were, half awake and half asleep.
V-84. The sixth plane is non-cognitive.
It is the station similar to deep sleep, having the nature of pure and massive bliss.
V-85. The seventh plane is (marked by) equability, utter purity, tenderness;
it is indeed unqualified liberation, the quiescent Fourth State.
V-86. The transcendent state beyond the Fourth, Nirvana in its essence, is the transcendent and developed seventh plane;
it does not come within the purview of mortals.
V-87. The first three constitute but the wakeful life;
the fourth is called the dream (state) where the world is regrettably dream-like.
V-88. The fifth, conforming to massive bliss, is styled deep sleep.
In contrast the sixth which is non-cognitive is named the Fourth State.
V-89. The most excellent seventh plane is the state beyond the Fourth,
beyond the range of mind and words,
and identified with the self-luminous Being.
(...)
2 - continua...
I SETTE BHUMIKA E IL LORO COLLEGAMENTO ALL'AUM - 1
Un'altra Upanisad in cui si parla dei sette stadi della conoscenza è la Akshi Upanisad, facente parte del Krishna-Yajur-Veda, ma in essa c'è qualcosa in più rispetto alle altre suesposte, perché in essa si fa accenno al collegamento con gli stati rappresentati dall'AUM:
AKSHI UPANISHAD
Translated by Dr. A. G. Krishna Warrier
*
PART-II
(…)
3. (The adepts) know Yoga to be the non-knowing (of plurality), the spontaneous attrition of the (object-seeking) mind.
Rooted in Yoga, perform actions, or, averse (to all actions), perform (them) not at all.
4. Aversion is felt everyday to inborn tendencies (to act); nevertheless, one tends to plunge into noble actions with gusto.
5-6. Always one hesitates as regards the instinctive actions of the unregenerate; one never refers to what may compromise others, but attends to their righteous deeds.
One does gentle deeds that pain none; always dreads sin and avoids all forms of sense-gratification.
7. Such a one’s speech is informed by affection and love; it is lovely and fit, with due regard to time and place.
8. With proper thought, act and speech, one waits upon the virtuous. Getting them from all conceivable sources, one studies the Shastras.
9-10(a). Then one attains the first stage of Yoga.
Whoever entertains such thoughts as regards the crossing of transmigratory life is said to have attained a state of Yoga. The rest are said to be just ‘noble’ (arya).
10(b)-11. Coming to the next stage of Yoga, called ‘Analysis’ (vichara), the sadhaka resorts to the foremost scholars, well-known for their serious interpretations of Sruti and Smriti, good conduct, fixed attention, contemplation and activities.
12. As a house-holder (knows) his homestead, (so), having mastered all that has to be learned, the sadhaka comes to know the categories, and the doctrines, vis-à-vis what has to be done and avoided.
13. As a snake sheds its Slough, so sheds he even a slight attachment to external objects when intensified by pride, conceit, intolerance, greed and delusion.
14. With a mind disciplined through devotion to the Shastras, teacher, and the company of the virtuous, he truthfully masters the entire body of knowledge including the secret doctrines.
15. Just as a lover repairs to a spotless bed of flowers, from the second, he (the sadhaka) proceeds to the third state styled Non-attachment.
16-17. Fixing his steady mind on the truthful import of the Shastras and busy with the recitation of spiritual texts proper to the hermitages of the ascetics, he expends his long life, seated on a bed of stone or a slab, diverting himself with ramblings in the forest, made beautiful by his placid mind.
18. As a result of his meritorious actions, the righteous (sadhaka) passes his time in the delights of detachment, repeatedly studying the positive Shastras.
19. One’s perception of reality becomes clear only in due course.
The enlightened one, reaching the third stage, experiences this for himself.
20. Non-attachment is of two kinds: listen to the distinction as it is being drawn. This non-attachment is of two-kinds; one general and the other, superior.
21. The general non-attachment is non-involvement in objects, (based on the perception) ‘I am neither agent nor enjoyer, neither the sublater nor the sublated’.
22. ‘Everything, be it pleasure or pain, is fashioned by prior deeds; or, everything is under the sway of the Lord. I do nothing in regard to it’.
23. ‘Enjoyments and non-enjoyments are dread diseases; possessions are great disasters.
All contacts just promote separation. Sufferings are diseases of thoughts’.
24. ‘Time is ceaselessly fashioning all things’ – so the general non-attachment of (the sadhaka) who has grasped the import of (the major texts) consists in being averse to all things and in not dwelling on them mentally.
25-26. By cultivating this sequence (of stages), the superior non-attachment in the case of the magnanimous (sadhakas) supervenes.
It is said to be silence, repose and quiescence.
For speech and import have been flung far away in the light of the truth, ‘I am no agent; the agent is God or my own prior actions’.
27. The first stage that occurs is sweet on account of the satisfaction and joy (that attend it).
The sadhaka (puman) has just stepped into the sequence of states.
The first is an ambrosial sprout.
28. The first stage is the internal, cleansed, birth-place of the other stages.
Thence one attains the second and third stages.
29. Among these, the all-pervading third (stage) is superior.
Here the sadhaka has outgrown all proneness to imagine (and get ensnared).
30. Those who reach the fourth (stage) after the dwindling of nescience through the exercises of the three stages look on all things with the same eye.
31. When non-duality is established and duality dissolved, those who have reached the fourth stage look upon the phenomenal world as a dream.
32. The first three states are said to be the waking state; the fourth is called the dream state.
And the mind dissolves like the fragments of an autumnal cloud.
33. He who reaches the fifth stage survives but as bare being.
Due to the dissolution of the mind in this stage the world-manifold does not present itself at all.
34. Reaching the fifth stage called ‘deep sleep’, the sadhaka remains as pure non-dual being, all particulars having completely vanished.
35. Having reached the fifth stage, one stays consolidated in deep sleep, joyful, inwardly awake, all dual appearances gone.
36. Looking inwards, even when attending to outer things, he appears always indrawn, being extremely exhausted.
37. Practising in this fifth stage, free from all innate impulses, one reaches, as a matter of course, the sixth stage named ‘the Fourth’.
38. Where there is neither the non-existent nor the existent, neither the ‘I’ nor the non-‘I’, with all analytic thinking gone, one stays alone, totally fearless, in non-duality.
39. Beyond knots, with all doubt vanquished, liberated in life, devoid of imaginations, though unextinguished yet extinguished, he is like a painted flame.
40. Having dwelt in the sixth stage, he shall reach the seventh.
The state of disembodied liberation is called the seventh stage of Yoga.
41-42(a). This is the acme of all stages, beyond words, quiescent.
Avoiding conformity with the ways of the world, and the ways of the body, avoiding conformity with Shastras, get rid of all superimpositions on the Self.
42(b). All that is (here), the vishva, the prajna, etc., is nothing but Om.
43. Because there is non-difference between import and expression, and because, as distinct from each other, neither of these two is known, the Vishva is just the letter ‘a’ and ‘u’ is said to be the Taijasa.
44. The Prajna is the letter ‘m’.
Thus know in order, discriminating with great effort, before Concentration (Samadhi) sets in.
45-46. In this due order the concrete and the subtle should all be dissolved in the spiritual Self and the spiritual Self (should be dissolved) perceiving ‘I am the Om Vasudeva, ever pure, awake, free, existent, non-dual massed and supreme bliss’; because all this (objective world) is pain in the beginning, middle and end.
47-48. Therefore, thou sinless one, renouncing everything, be devoted to Truth.
Think: I am Brahman, solid Intelligence and Bliss, free from impurity, holy, lifted above mind and words, beyond the darkness of ignorance, beyond all appearances.
This is the secret doctrine.
3. continua...
I SETTE BHUMIKA E IL LORO COLLEGAMENTO ALL'AUM – 2
L'Upanisad nella quale questo collegamento tra gli stadi di conoscenza (7 Bhumika) e gli stati rappresentati dall'AUM sono veramente esposti in tutta chiarezza è la Varaha Upanisad, appartenente al Krishna-Yajur-Veda. Ve ne propongo il testo, suddiviso secondo i sutra in inglese, prima in sanscrito, poi nella traduzione inglese:
VARAHA UPANISHAD
Translated in English by K. Narayanasvami Aiyar
*
CHAPTER – IV
atha ha rbhum bhagavantam nidaghah papraccha jivanmuktilaksanamanubruhiti |
tatheti sa hovaca |
On another occasion Nidagha asked Lord Ribhu to enlighten him as to the characteristics of Jivanmukti.
To which Ribhu replied in the affirmative and said the following:
saptabhumisu jivanmuktascatvarah |
subheccha prathama bhumika bhavati |
vicarana dvitiya |
tanumanasi trtiya |
sattvapattisturiya |
asamsaktih pancami |
padarthabhavana sasthi |
turiyaga saptami |
“In the seven Bhumikas (or stages of development of wisdom) there are four kinds of Jivanmuktas.
Of these the first stage is Subhechcha (good desire); the second is Vicharana (inquiry); the third is Tanumanasi (or pertaining to the thinned mind); the fourth is Sattvapatti (the attainment of Sattva); the fifth is Asamsakti (non-attachment); the sixth is the Padartha-Bhavana (analysis of objects) and the seventh is the Turya (fourth or final stage).
pranavatmika bhumika akarokaramakarardhamatratmika |
sthulasuksmabijasaksibhedenakaradayascaturvidhah |
tadavastha jagratsvapnasusuptituriyah |
The Bhumika which is of the form of Pranava (Om) is formed of (or is divided into) Akara – ‘A’, Ukara – ‘U’, Makara - ‘M’ and Ardha-Matra.
Akara and others are of four kinds on account of the difference of Sthula (gross), Sukshma (subtle), Bija (seed or causal) and Sakshi (witness).
Their Avasthas are four: waking, dreaming, dreamless sleeping and Turya (fourth).
akarasthulamse jagradvisvah |
suksmamse tattaijasah |
bijamse tatprajnah |
saksyamse tatturiyah |
He who is in (or the entity that identifies itself with) the waking state in the gross Amsa (essence or part) of Akara is named Vishva; in the subtle essence, he is termed Taijasa; in the Bija essence, he is termed Prajna; and in the Sakshi essence, he is termed Turya.
ukarasthulamse susuptavisvah |
suksmamse tattaijasah |
bijamse tatprajnah |
saksyamse tatturiyah |
He who is in the dreaming state (or the entity which identifies itself with the dreaming state) in the gross essence of Ukara is Vishva; in the subtle essence, he is termed Taijasa; in the Bija essence, is termed Prajna; and in the Sakshi essence, he is termed Turya.
makarasthulamse susuptavisvah |
suksmamse tattaijasah |
bijamse tatprajnah |
saksyamse tatturiyah |
He who is in the Sushupti state in the gross essence of Makara is termed Vishva; in the subtle essence, Taijasa; in the Bija essence, he is termed Prajna; and in the Sakshi essence, he is termed Turya.
ardhamatrasthulamse turiyavisvah |
suksmamse tattaijasah |
bijamse tatprajnah |
saksyamse turiyaturiyah |
He who is in Turya State in the gross essence of Ardha-Matra is termed Turya-Vishva.
In the subtle, he is termed Taijasa; in the Bija essence, he is termed Prajna; and in the Sakshi essence, he is termed Turya-Turya.
akaraturiyamsah prathamadvitiyatrtiyabhumikah |
ukaraturiyamsa caturthi bhumika |
makaraturiyamsa pancami |
ardhamatraturiyamsa sasthi |
tadatita saptami |
The Turya essence of Akara is (or embraces) the first, second and third (Bhumikas or stages of the seven).
The Turya essence of Ukara embraces the fourth Bhumika.
The Turya essence of Makara embraces the fifth Bhumika.
The Turya essence of Ardha-Matra is the sixth stage.
Beyond this, is the seventh stage.
bhumitrayesu viharanmumuksurbhavati |
turiyabhumyam viharanbrahmavidbhavati |
pancamabhumyam viharanbrahmavidvaro bhavati |
sasthabhumyam viharanbrahmavidvariyanbhavati |
saptamabhumyam viharanbrahmavidvaristho bhavati |
One who functions in the (first) three Bhumikas is called Mumukshu; one who functions in the fourth Bhumika is called a Brahmavit; one who functions in the fifth Bhumika is called a Brahmavidvara; one who functions in the sixth Bhumika is called a Brahmavidvariya; and one in the seventh Bhumika is called a Brahmavidvarishtha.
tatraite sloka bhavanti |
With reference to this, there are Slokas. They are:
jnanabhumih subheccha syatprathama samudirita |
vicarana dvitiya tu trtiya tanumanasa || 1||
1. Subhechcha is said to be the first Jnana-Bhumi (or stage of wisdom); Vicharana, the second; Tanumanasi, the third;
sattvapattiscaturthi syattato'samsaktinamika |
padarthabhavana sasthi saptami turyaga smrta || 2||
2. Sattvapatti, the fourth; then come Asamsakti as the fifth, Padartha-Bhavana as the sixth and Turya as the seventh.
sthitah kim mudha evasmi preksyo'ham sastrasajjanaih |
vairagyapurnamiccheti subhecchetyucyate budhaih || 3||
3. The desire that arise in one through sheer Vairagya (after resolving) ‘Shall I be ignorant? I will be seen by the Shastras and the wise’ (or ‘I will study the books and be with the wise’) – is termed by the wise as Subhechcha [first stage].
sastrasajjanasamparkavairagyabhyasapurvakam |
sadacarapravrttirya procyate sa vicarana || 4||
4. The association with the wise and Shastras and the following of the right path preceding the practice of indifference is termed Vicharana [second stage].
vicaranasubhecchabhyamindriyarthesu raktata |
yatra sa tanutameti procyate tanumanasi || 5||
5. That stage wherein the hankering after sensual objects is thinned through the first and second stages is said to be Tanumanasi [third stage].
bhumikatritayabhyasacitte'rthaviratervasat |
satvatmani sthite suddhe sattvapattirudahrta || 6||
6. That stage wherein having become indifferent to all sensual objects through the exercise in the (above) three stages, the purified Chitta rests on Atman which is of the nature of Sat is called Sattvapatti [fourth stage].
dasacatustayabhyasadasamsargaphala tu ya |
rudhasattvacamatkara prokta samsaktinamika || 7||
7. The light (or manifestation) of Sattva-Guna that is firmly rooted (in one) without any desire for the fruits of actions through the practice in the above four stages is termed Asamsakti [fifth stage].
bhumikapancakabhyasatsvatmaramataya bhrsam |
abhyantaranam bahyanam padarthanamabhavanat || 8||
paraprayuktena ciram pratyayenavabodhanam |
padarthabhavananama sasthi bhavati bhumika || 9||
8-9. That stage wherein through the practice in the (above) five stages one, having found delight in Atman, has no conception of the internals or externals (though before him) and engages in actions only when impelled to do so by others is termed Padartha-Bhavana, the sixth stage.
sadbhumikacirabhyasadbhedasyanupalambhanat |
yatsvabhavaikanisthatvam sa jneya turyaga gatih || 10||
10. The stage wherein after exceedingly long practice in the (above) six stages one is (immovably) fixed in the contemplation of Atman alone without the difference (of the universe) is the seventh stage called Turya.
subhecchaditrayam bhumibhedabhedayutam smrtam |
yathavadveda buddhyedam jagajjagrati drsyate || 11||
11. The three stages beginning with Subhechcha are said to be attained with (or amidst) differences and non-differences. (Because) the universe one sees in the waking state he thinks to be really existent.
advaite sthairyamayate dvaite ca prasamam gate |
pasyanti svapnavallokam turyabhumi suyogatah || 12||
12. When the mind is firmly fixed on the non-dual One and the conception of duality is put down, then he sees this universe as a dream through his union with the fourth stage.
vicchinnasaradabhramsavilayam praviliyate |
satvavasesa evaste hi nidagha drdhikuru || 13||
13. As the autumnal cloud being dispersed vanishes, so this universe perishes. O Nidagha, be convinced that such a person has only Sattva remaining.
pancabhumim samaruhya susuptipadanamikam |
santasesavisesamsastisthatyadvaitamatrake || 14||
14. Then having ascended the fifth stage called Sushuptipada (dreamless sleeping seat), he remains simply in the non-dual state, being freed from all the various differences.
antarmukhataya nityam bahirvrttiparo'pi san |
parisrantataya nityam nidraluriva laksyate || 15||
kurvannabhyasametasyam bhumyam samyagvivasanah |
saptami gadhasuptakhya kramaprapta puratani || 16||
15-16(a). Having always introvision though ever participating in external actions, those that are engaged in the practice of this (sixth stage) are seen like one sleeping when fatigued (viz., being freed from all affinities).
16(b). (Lastly) the seventh stage which is the ancient and which is called Gudhasupti is generally attained.
yatra nasanna sadrupo naham napyanahankrtih |
kevalam ksinamanana aste'dvaite'tinirbhayah || 17||
17. Then one remains in that secondless state without fear and with his consciousness almost annihilated where there is neither Sat nor Asat, neither self nor not-self.
antahsunyo bahihsunyah sunyakumbha ivambare |
antahpurno bahihpurnah purnakumbha ivarnave || 18||
18. Like an empty pot in the Akasa, there is void both within and without; like a filled vessel in the midst of an ocean, he is full both within and without.
ma bhava grahyabhavatma grahakatma ca ma bhava |
bhavanamakhilam tyaktva yacchistam tanmayo bhava || 19||
19. Do not become either the knower or the known. May you become the Reality which remains after all thoughts are given up.
drstrdarsanadrsyani tyaktva vasanaya saha |
darsanaprathamabhasamatmanam kevalam bhaja || 20||
20. Having discarded (all the distinctions of) the seer, the sight and the seen with their affinities, meditate solely upon Atman which shines as the supreme Light.
(…)
4. continua...
VARAHA UPANISAD
Considerata l'importanza di questa Upanisad, ne propongo un'approssimativa traduzione letterale in italiano:
VARAHA UPANISAD
Capitolo IV
***
In un’altra occasione Nidagha chiese a Lord Ribhu di illuminarlo sulle caratteristiche della Jivanmukti. Al che Ribhu rispose in modo affermativo e disse ciò che segue:
“Nei sette Bhumika (o fasi dello sviluppo della conoscenza) ci sono quattro tipi di Jivanmukta.
Di queste la prima fase è Subhechcha (buona volontà);
la seconda è Vicharana (indagine);
la terza è Tanumanasi (o relativo all’assottigliamento della mente);
la quarta è Sattvapatti (il conseguimento di Sattva);
la quinta è Asamsakti (non-attaccamento);
la sesta è Padartha-Bhavana (analisi degli oggetti);
e la settima è Turiya (Quarto, o fase finale).
Il Bhumika che è della stessa forma del Pranava (OM) è formato da (o è diviso in) Akara - ‘A’, Ukara – ‘U’, Makara - ‘M’ e Ardha-Matra.
Akara e gli altri sono di quattro tipi a causa delle differenze tra Sthula (materia), Sukshma (sottile), Bija (seme o causale) e Sakshi (testimone).
I loro stati sono quattro: veglia, sogno, sonno profondo e Turiya (Quarto).
Colui che è ne (o l’entità che s’identifica con) lo stato di veglia nell’Amsa (essenza o parte) dello stato materiale di Akara è chiamato Vishva; nell’essenza sottile è detto Taijasa; nell’essenza causale è detto Prajna; e nella parte del Testimone è denominato Turiya.
Colui che è nello stato di sogno (o l’entità che s’identifica con lo stato di sogno) nella parte materiale di Ukara è Vishva; nell’essenza sottile è detto Taijasa; nell’essenza causale è detto Prajna; e nella parte del Testimone è denominato Turiya.
Colui che è nello stato di sonno profondo nella parte materiale di Makara è denominato Vishva; nell’essenza sottile, Taijasa; nell’essenza causale è detto Prajna; e nella parte del Testimone è denominato Turiya.
Colui che si trova nello stato di Turiya nella parte materiale di Ardha-Matra è definito Turiya-Vishva. Nel sottile, è detto Taijasa; nell’essenza causale è detto Prajna; e nella parte del Testimone è denominato Turiya-Turiya.
L'essenza Turiya di Akara è (o abbraccia) il primo, il secondo e il terzo (Bhumika o fase dei sette).
L'essenza Turiya di Ukara abbraccia il quarto Bhumika.
L'essenza Turiya di Makara abbraccia il quinto Bhumika.
L'essenza Turiya di Ardha-Matra è il sesto stadio.
Oltre questo, c’è il settimo stadio.
Uno che opera nei (primi) tre Bhumika è chiamato Mumukshu; uno che opera nel quarto Bhumika è chiamato Brahmavit; uno che opera nel quinto Bhumika è detto Brahmavidvara; uno che opera nel sesto Bhumika è chiamato Brahmavidvariya; e uno nel settimo Bhumika è denominato Brahmavidvarishtha.
In riferimento a tutto questo, ci sono dei sutra. Essi sono:
1. Subhechcha è detto essere il primo Jnana-Bhumi (o fase della conoscenza); Vicharana il secondo; Tanumanasi il terzo;
2. Sattvapatti il quarto; poi come quinto viene Asamsakti, come sesto Padartha-Bhavana e come settimo Turiya.
3. Il desiderio che nasce in chi, attraverso il puro Vairagya (dopo aver risolto) ‘Devo essere ignorante? Frequenterò gli Shastra e il saggio’ (o ‘Studierò i libri e frequenterò il saggio’) – è denominato dal saggio come Subhechcha [prima tappa].
4. L’associazione con il saggio e lo studio degli Shastra e il seguire il giusto percorso che precede la pratica di vairagya è detto Vicharana [seconda fase].
5. Quella fase in cui il desiderio per gli oggetti dei sensi si è assottigliato attraverso la prima e la seconda tappa, è denominate Tanumanasi [terza fase].
6. Quella fase in cui, dopo essere diventati indifferenti agli oggetti dei sensi attraverso l’esercizio dei (summenzionati) tre stadi, la Chitta purificata si riposa nell’Atman, che è della natura di Sat, è chiamata Sattvapatti [quarta fase].
7. La luce (o la manifestazione) del guna Sattva, che è stabilmente radicata in chi, attraverso la pratica nelle suddette quattro tappe sia senza alcun desiderio per i frutti delle azioni, è denominata Asamsakti [quinta fase].
8-9. Quella fase in cui attraverso la pratica nelle (suesposte) tappe uno, avendo trovato diletto nell’Atman, non è influenzato degli oggetti interni o esterni (sebbene posti di fronte a lui) e si impegna in azioni solo quando è spinto dagli altri a farlo, è denominata Padartha-Bhavana, la sesta fase.
10. La fase in cui, dopo una pratica estremamente lunga nei (sumenzionati) sei stadi, uno è inamovibilmente stabilizzato nella contemplazione dell’Atman soltanto, senza differenziazione (dell’universo), è la settima fase detta Turiya.
11. Le tre fasi che iniziano con Subhechcha devono essere realizzate con (o in mezzo a) le distinzioni e le non-distinzioni. (Poiché) l’universo che uno vede nello stato di veglia egli lo ritiene realmente esistente.
12. Quando la mente è saldamente fissata sull’Uno non-duale e la concezione della dualità è abbandonata, allora egli vede questo universo come un sogno attraverso la sua unione con la quarta fase.
13. Come le nubi autunnali vengono disperse dal vento e svaniscono, così quest’universo scompare. O Nidagha, convinciti che in tale persona rimane solo Sattva.
14. Ormai, essendo asceso alla quinta fase chiamata Sushuptipada (stadio del sonno senza sogni), egli rimane semplicemente nello stato non-duale, libero da ogni differenziazione.
15-16 (a). Mantenendo sempre l’introversione e tuttavia mai prendendo parte ad azioni esterne, quelli che sono impegnati nella pratica di questo (sesto stadio) sono considerati come chi dorme quando è affaticato (ossia, essendo liberi da ogni legame).
16 (b). (Infine), la settima fase, che è quella primeva e che è chiamata Gudhasupti, viene generalmente ottenuta.
17. Allora uno rimane privo di timore in quello stato senza-Secondo e con la propria consapevolezza quasi annullata dove non esiste né Sat né Asat, né Sé né non-Sé.
18. Come in un vaso vuoto nell’Etere non c’è nulla né dentro né fuori; come un’imbarcazione stracarica nel mezzo dell’oceano, egli è pieno sia dentro che fuori.
19. Non diventare né il conoscitore né il conosciuto. Che tu possa divenire la Realtà che rimane dopo che tutti i pensieri sono cessati.
20. Dopo aver eliminato (tutte le distinzioni di) veggente, azione del vedere e oggetto visto con le loro affinità, medita unicamente sull’Atman, che risplende come Luce suprema.
(…)
5. continua...
LA MÂNDUKYA UPANISAD
Quanto viene detto nella Varaha Upanisad riguardo all'AUM, consente di apprezzare in tutta la sua estensione ciò che molto sinteticamente veniva esposto nella ben più nota Mandukya Upanisad (siccome in questo momento non riesco più a trovare la traduzione in italiano di Raphael, ne trascrivo una trovata on line con la traduzione dal sanscrito fatta da Sri Aurobindo):
MÂNDUKYA UPANISAD
dal sito web http://www.arianuova.org
*
omitietadaksharamidam sarvam tasyopavyâkhyânam
bhûtam bhavad bhavishyaditi sarvamomkâra eva;
yaccânyat trikâlâtîtam tadapyomkâra eva.
«OM è la Parola imperitura; OM è l’universo; e questa ne è l’esposizione. Il passato, il presente e il futuro, ciò che è esistito, che è e che sarà, è OM. Tutto ciò che esiste oltre i limiti del tempo, è pur esso designato da OM».
Verso 2
sarvam hyetad brahma ayam âtmâ brahma so’yam âtmâ catushpât.
«Tutto questo universo è il Brahman; questo âtman è il Brahman, e l’âtman è quadruplice».
Verso 3
jâgaritasthâno bahishprajñah saptânga ekornâmvashatimukhah sthûlabhug vaishvânarah prathamah pâdah.
«Colui che ha come sede lo stato di veglia, che possiede la conoscenza degli oggetti esteriori, dotato di sette membra e diciannove porte, che fruisce del mondo materiale, Vaishvânara, è il primo».
Verso 4
svapnasthâno’ntahprajñah saptânga ekornâmvashatimukham praviviktabhuk taijaso dvitîyah pâdah.
«Colui che ha come sede lo stato di sogno, che ha la conoscenza degli oggetti interiori, dotato di sette membra e diciannove porte, che fruisce degli oggetti sottili, Taijasa, è il secondo».
Verso 5
yatra supto na kancana kâmam kâmayate
na kancana svapnam pashyati tat sushuptam
sushuptasthâna ekî-bhûtah prajñânaghana evânandamayo hyânndabhuk cetomukhah prâjñâstritîyah pâdah.
«Quando l’essere dormiente non prova più desiderî, né è soggetto a sogni, allora si ha la condizione di sonno profondo. Colui che dimora nel sonno profondo, e che in questo è diventato uno, che è conoscenza raccolta in se stessa, che è costituito da pura beatitudine, che ha la beatitudine come campo di esperienza, la cui mente cosciente è la porta, Prâjña, è il terzo».
Verso 6
esha sarveshvara esha sarvajña esho’ntaryâmyesha yonih sarvasya prabhavâpyayau hi bhûtânâm.
«Esso è il Signore di tutto, l’Onnisciente, l’ordinatore interno, matrice dell’universo, l’origine e la fine di tutte le creature».
Verso 7
nântahprajña na bahishprajña nobhayatahprajñam na prajñânaghanam na prajñam nâprajñam;
adrishtam asyavahâryamagrâhyama lakshanamacintyamavyapadeshyamekâtmapratyayasâram prapancopashamam shântam shivam advaitam
caturtham manyante sa âtmâ sa vijñeyah.
«Il Quarto non è estroverso né introverso, né contemporaneamente dentro e fuori, non è conoscenza raccolta in se stessa, non possiede la conoscenza né la non-conoscenza, è invisibile e incomprensibile, indefinibile, impensabile, indescrivibile, l’unica essenza della conoscenza dell’âtman, senza alcuna traccia fenomenica; è pienezza di pace e di beatitudine senza dualità: questo è in verità l’Âtman, questo è l’oggetto della conoscenza».
Verso 8
so’yamâtmâdhyaksharamonkâ ro’dhimâtram pâdâ mâtrâ mâtrâshca pâdâ akâra ukâro makâra iti.
«Egli è l’Atman, è il Verbo imperituro, è OM; e ogni lettera è una sua parte: A, U, M».
Verso 9
jâgaritasthano vaishvânaro’kâroh prathamâ mâtrâ âpterâdimattvâd vâ âpnoti ha vai sarvân kâmânâ dishca bhavati ya evam veda.
«Vaishvânara, la cui sede è lo stato di veglia, è designato dalla prima lettera, la A, a causa della sua connessione con ciò che ha inizio e si espande. Colui il quale così conosce, consegue tutti gli oggetti di desiderio: ne diventa la sorgente e l’origine».
Verso 10
svapnasthânastaijasa ukâro dvitoyâ mâtrâ uktarshâbhayanvâd vâ uktarshati vai jñânasarntati ha vai jñâmânashca samânashca bhavati nâsyâbrahmavit kule bhavati ya evam veda.
«Taijasa, la cui sede è lo stato di sogno, è designato dalla seconda lettera, la U, in correlazione con avanzamento e centralità; chi in tal modo conosce, raggiunge il flusso ininterrotto di conoscenza e si eleva oltre l’indifferenza: nessuno dei suoi semi sarà privo della conoscenza del Brahman».
Verso 11
sushuptasthânah prâjño makârastritîyâ mâtrâ miterapotervâ minoti ha vâ idam sarvamapîtishca ya evam deva.
«Prâjña, la cui sede è lo stato di sonno profondo, è designato dalla terza lettera, la M, a causa della connessione con misura e finalità; colui che conosce l’universo in se stesso come misura diventa, in realtà, onnipenetrante».
Verso 12
amâtrashcaturthe’vyavahâryah prapanciopashamah
shive’dvaita evamonkâra âtmaiva samvishatyâtmanâtmânam
ya evam veda ya evam veda.
«Il Quarto stato è incommensurabile, non agente, al di là della manifestazione; è il Sommo Bene, l’Uno senza secondo: è OM. Colui il quale così conosce, diventa l’Âtman, e mediante il proprio âtman penetra nell’Âtman — colui il quale così conosce».
6. continua...
I SEDICI STATI DI COSCIENZA
Nella Paramahamsa-Parivrajaka Upanishad, facente parte dell'Atharva-Veda, possiamo trovare conferma alla suddivisione in sedici stati di coscienza, già esposti nella Varaha Upanisad:
PARAMAHAMSA-PARIVRAJAKA UPANISHAD
Translated by Prof. A. A. Ramanathan
***
(…)
4. The god Brahma asked (Narayana):
Lord, what is Brahma-Pranava ?
(The Lord) Narayana replied:
The Brahma-Pranava consists of sixteen parts and it is cognized in quadruples in the four states (waking, etc.,).
In the waking state there are the four states, waking within waking, etc., (jagrat-jagrat);
in the dreaming state the four states are waking within dreaming, etc., (svapna-jagrat);
in deep sleep there are the four states waking within deep sleep, etc., (susupti-jagrat);
in the fourth state (turiya) there are the four states waking within the Turiya, etc., (turiya-jagrat).
In the waking state of distributive pervasion (vyashti) there is quadruplicity of vishva, namely, vishva-vishva, vishva-taijasa, vishva-prajna and vishva-turiya.
In the dreaming state of distributive pervasion there is quadruplicity of taijasa, namely taijasa-vishva, taijasa-taijasa, taijasa-prajna and taijasa-turiya.
In the state of deep sleep of Prajna there is quadruplicity, namely prajna-vishva, prajna-taijasa, prajna-prajna and prajna-turiya.
In the fourth state (turiya) there is the quadruplicity of the turiya, namely turiya-vishva, turiya-taijasa, turiya-prajna (and turiya-turiya).
These in due order make up the sixteen parts.
In the letter ‘a’ (of the Om – Aum) there is jagrat-vishva, in the letter ‘u’ jagrat-taijasa, in the letter ‘m’ jagrat-prajna, in the ardha-matra (of Om) jagrat-turiya, in the bindu svapna-vishva, in the nada svapna-taijasa, in the kala svapna-prajna, in the kalatita svapna-turiya, in the shanti susupta-vishva, in the shantyatita susupta-taijasa, in pashyanti turiya-prajna, in para turiya-turiya.
The four parts of jagrat pertain to the letter ‘a’, the four parts of Svapna pertain to the letter ‘u’, the four parts of Susupti pertain to the letter ‘m’, the four parts of turiya pertain to the ardha-matra.
This is the Brahma-Pranava.
This is to be worshipped by the Paramahamsa, Turiyatita and Avadhuta ascetics.
By this Brahman is illumined.
(This is) liberation in the disembodied state (Videha-mukti).
7. continua...
LE IMPLICAZIONI DEI SEDICI STATI DI COSCIENZA
Alla luce di quanto esposto finora, è abbastanza facile comprendere la sequenza dei sedici stati di coscienza che è necessario risvegliare man mano che si avanza nel proprio cammino prima di giungere alla piena Realizzazione spirituale.
Si può pertanto stilare quanto segue:
1. Esiste uno STATO DI VEGLIA (VISVA) corrispondente alla A (AKARA) di AUM, a sua volta composto da uno stato di veglia (A - visva), uno stato di sogno (U – taijasa) e uno stato di sonno profondo (M – prajna).
2. Esiste uno STATO DI SOGNO (TAIJASA) corrispondente alla U (UKARA) di AUM, a sua volta composto da uno stato di veglia (A - visva), uno stato di sogno (U – taijasa) e uno stato di sonno profondo (M – prajna).
3. Esiste uno STATO DI SONNO PROFONDO (PRAJNA) corrispondente alla M (MAKARA) di AUM, a sua volta composto da uno stato di veglia (A - visva), uno stato di sogno (U – taijasa) e uno stato di sonno profondo (M – prajna).
Osservazioni:
a) “1. STATO DI VEGLIA (VISVA)” è quello cosiddetto dei “Piccoli Misteri” ed è di carattere individuale, mentre “2. STATO DI SOGNO (TAIJASA)” e “3. STATO DI SONNO PROFONDO (PRAJNA)” sono già parte dei “Grandi Misteri” e sono di carattere universale.
b) Ognuno di questi stati principali (1. VISVA, 2. TAIJASA, 3. PRAJNA) si conclude con una realizzazione che possiamo considerare l'Ardha Matra di quello stato e che rappresenta l'Unione non definitiva con il Divino/Dio/Sé.
Anche tutti gli stati interni a ognuno di questi stati principali (A- stato di veglia, U- stato di sogno, M- stato di sonno profondo), possono dare luogo a parziali realizzazioni, che servono, primariamente, a segnalare lo stato di avanzamento coscienziale al quale si è giunti.
c) Questi tre primi stati principali corrispondono al I, II, III Buhmika o stadi di conoscenza (chi li sta esperendo è detto MUMUKSHU):
I Bhumika - corrisponde a: “1. STATO DI VEGLIA (VISVA)” ed è detto SUBHECCHA (desiderio d’illuminazione)
II Bhumika - corrisponde a: “2. STATO DI SOGNO (TAIJASA)” ed è detto VICHARANA (indagine)
III Bhumika - corrisponde a: “3. STATO DI SONNO PROFONDO (PRAJNA)” ed è detto TANUMANASA (mente tenue)
4. Esiste infine uno stato chiamato il QUARTO (TURIYA) corrispondente all'ARDHA MATRA di AUM, a sua volta composto da uno stato di veglia (A - visva), uno stato di sogno (U – taijasa), uno stato di sonno profondo (M – prajna) e uno stato di Turiya (ardha matra).
Osservazioni:
a) Nello stato “4. QUARTO (TURIYA)” si concentrano gli ultimi quattro Bhumika o stadi di conoscenza:
IV Bhumika - corrisponde a: "A - visva" ed è detto SATWAPATTI (autorealizzazione)
V Bhumika - corrisponde a: "U – taijasa" ed è detto ASAMSAKTI (non attaccamento)
VI Bhumika - corrisponde a: "M – prajna" ed è detto PADARTHABHAVANA (non percezione degli oggetti)
VII Bhumika - corrisponde a: ardha matra ed è detto TURYAGA (trascendenza)
b) Il IV Bhumika rappresenta l'AUTOREALIZZAZIONE tanto ambita: al termine dello stato TURIYA-VISVA (cioè quando si è all'ardha matra dello stato di veglia del Quarto) si è un JIVANMUKTA (liberato in vita) e un JNANI (conoscitore) a tutti gli effetti.
c) Chi si trova nel IV Bhumika è detto BRAHMAVIT, chi è nel V Bhumika è detto BRAHMAVIDVARA, chi si trova nel VI Bhumika è detto BRAHMAVIDVARIYA, mentre chi sta esperendo l'ultimo Bhumika è considerato un BRAHMAVIDVARISTHA.
d) Siccome tutti gli stati di coscienza principali si ripetono anche nel Quarto e poiché ognuno dei sottostati di AUM si ripete per ben quattro volte, è facile capire come ci si possa sbagliare e ritenersi già “arrivati” quando invece non lo si è. Di qui l'importanza di essere seguiti da chi il percorso l'ha sicuramente già esperito.
Qui si conclude questa lunga esposizione.
8 - fine.
Yati, tratto da forum pitagorico, Vedanta & Co, 11.03.2010
Vidya Bharata - Edizioni I Pitagorici © Tutti i diritti riservati.
Tutti i diritti su testi e immagini contenuti nel sito sono riservati secondo le normative sul diritto d’autore.
I sette stadi di conoscenza (7 bhumika)